General Information

  • ID:  hor006508
  • Uniprot ID:  Q9Y581
  • Protein name:  Insulin-like peptide INSL6 B chain
  • Gene name:  INSL6
  • Organism:  Homo sapiens (Human)
  • Family:  Insulin family
  • Source:  Human
  • Expression:  Testis specific.
  • Disease:  Diseases associated with INSL6 include Myeloproliferative Neoplasm and Polycythemia Vera.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008150 biological_process
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  RELSDISSARKLCGRYLVKEIEKLCGHANWSQF
  • Length:  33(21-53)
  • Propeptide:  MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVTKIY
  • Signal peptide:  MPRLLRLSLLWLGLLLVRFS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have a role in sperm development and fertilization.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9Y581-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006508_AF2.pdbhor006508_ESM.pdb

Physical Information

Mass: 440938 Formula: C168H270N50O49S2
Absent amino acids: MPT Common amino acids: LS
pI: 8.79 Basic residues: 7
Polar residues: 10 Hydrophobic residues: 11
Hydrophobicity: -47.88 Boman Index: -7421
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 85.76
Instability Index: 2679.09 Extinction Coefficient cystines: 7115
Absorbance 280nm: 222.34

Literature

  • PubMed ID:  10598589
  • Title:  Cloning of two novel mammalian paralogs of relaxin/insulin family proteins and their expression in testis and kidney.
  • PubMed ID:  10819760
  • Title:  Identification of INSL6, a new member of the insulin family that is expressed in the testis of the human and rat.
  • PubMed ID:  15164053
  • Title:  DNA sequence and anal
  • PubMed ID:  15489334
  • Title: